PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.001G251100.1
Common NamePHAVU_001G251100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family EIL
Protein Properties Length: 448aa    MW: 51087.7 Da    PI: 4.7309
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.001G251100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3374.51.7e-114263392353
                         XXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   2 elkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLr 92 
                          lkkrmwkd++ll++lke++++    +e++ +a       e++rrkkmsraQD +LkYM+k+mevcnaqGfvYgiipekgkpv+g+sdsLr
  Phvul.001G251100.1  26 QLKKRMWKDRILLQKLKEKREK----QEPDKEA-----KIEASRRKKMSRAQDLVLKYMVKIMEVCNAQGFVYGIIPEKGKPVSGSSDSLR 107
                         69***************99998....4552222.....35889************************************************ PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHH CS
                EIN3  93 aWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwge 183
                         +WWk++++fd+ +p ai +y     +l++++    + +s+ h l++lqD+tlgSLLsal qhc ppqr+fple+g++pPWWPtG+elwwge
  Phvul.001G251100.1 108 EWWKDQIRFDQSAPSAILNYL---PLLEKDKM---DITSYIHLLQDLQDSTLGSLLSALRQHCVPPQRKFPLERGLSPPWWPTGEELWWGE 192
                         ********************3...35554444...479***************************************************** PP

                         HT.--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXXXXXXXXXX CS
                EIN3 184 lg.lskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahssslrkqspk 273
                         +g l++++g+ppy+kphdlkkawkvsvL+a ikh+sp+++++r+l+ qsk lqdkm+a++s ++++v+nqee ++               k
  Phvul.001G251100.1 193 QGlLAQEHGAPPYRKPHDLKKAWKVSVLAAIIKHISPDFDKLRRLVTQSKTLQDKMTARDSSTWSKVMNQEEVLL-----------GITGK 272
                         **9999999**************************************************************9866...........24566 PP

                         XXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
                EIN3 274 vtlsceqkedvegkkeskikhvqavkttagfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                         + ls+e   dve ++e + +        ++ +   krk  +++    s+ +  + cq+ ++++s+ +++f d+n++ ++e
  Phvul.001G251100.1 273 LSLSNE---DVENHEEGEGS--G-----SDSAQLLKRKVSFGSG---SEDDKLYACQNVECPQSKLSMGFVDRNARLDHE 339
                         777766...44444444422..1.....2334456666344433...333447***********************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.5E-11226264No hitNo description
Gene3DG3DSA:1.10.3180.101.9E-64138266IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.22E-57142266IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MVLINEEIDP YITEEENQDE SIDYDQLKKR MWKDRILLQK LKEKREKQEP DKEAKIEASR  60
RKKMSRAQDL VLKYMVKIME VCNAQGFVYG IIPEKGKPVS GSSDSLREWW KDQIRFDQSA  120
PSAILNYLPL LEKDKMDITS YIHLLQDLQD STLGSLLSAL RQHCVPPQRK FPLERGLSPP  180
WWPTGEELWW GEQGLLAQEH GAPPYRKPHD LKKAWKVSVL AAIIKHISPD FDKLRRLVTQ  240
SKTLQDKMTA RDSSTWSKVM NQEEVLLGIT GKLSLSNEDV ENHEEGEGSG SDSAQLLKRK  300
VSFGSGSEDD KLYACQNVEC PQSKLSMGFV DRNARLDHEA LCAYRIEDSY LPFHRYLSNE  360
ASPITSVDDW MNVAIQNDAK VVEAAGGSGT LEDNACYWLN GVENLELEAA LEMLLNDNED  420
FDQNPVQIPQ VQEDATSIWD LPWHPSQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_B2e-531402661126Protein ETHYLENE INSENSITIVE 3
4zds_A2e-531402661126Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007163637.10.0hypothetical protein PHAVU_001G251100g
SwissprotQ9LX161e-131EIL4_ARATH; Putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLV7D3300.0V7D330_PHAVU; Uncharacterized protein
STRINGGLYMA18G02190.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.11e-129EIL family protein